Antibodies

Jump to Filters
View as table Download
Plexin A4 (PLXNA4) Rabbit Polyclonal Antibody
TA344306

USD 475.00

5 Days

Rabbit Polyclonal Anti-PLXNA4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLXNA4 antibody: synthetic peptide directed towards the middle region of human PLXNA4. Synthetic peptide located within the following region: TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV
Plexin A4 (PLXNA4) Rabbit Polyclonal Antibody
TA380068

USD 220.00

3 Weeks

PLXNA4 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-220 of human PLXNA4 (NP_861440.2).
Modifications Unmodified