Rabbit Polyclonal Anti-TRPC4 (extracellular)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide (C)KYSALNPRESWD, corresponding to amino acid residues 458-469 of rat TRPC4. 2nd extracellular loop. |
Rabbit Polyclonal Anti-TRPC4 (extracellular)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide (C)KYSALNPRESWD, corresponding to amino acid residues 458-469 of rat TRPC4. 2nd extracellular loop. |
Rabbit Polyclonal Anti-TRPC4
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)KEKHAHEEDSSIDYDL, corresponding to amino acid residues 943-958 of mouse TRPC4.Intracellular, C-terminus. |
Goat Anti-TRPC4 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KHAKEEDSSIDYD, from the internal region (near C-Terminus) of the protein sequence according to NP_057263.1. |
TRPC4 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 811-840 amino acids from the C-terminal region of human TRPC4 |
Rabbit Polyclonal Anti-TRPC4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPC4 antibody: synthetic peptide directed towards the middle region of human TRPC4. Synthetic peptide located within the following region: CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL |
TRPC4 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 768-977 of human TRPC4 (NP_057263.1). |
Modifications | Unmodified |