Antibodies

Jump to Filters
View as table Download
VMAT2 (SLC18A2) Rabbit Polyclonal Antibody
TA309861

USD 555.00

In Stock

Rabbit Polyclonal VMAT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human VMAT2 protein (within residues 30-200). [Swiss-Prot Q05940]
TRPC1 Rabbit Polyclonal Antibody
TA328677

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-TRPC1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide QLYDKGYTSKEQKDC, corresponding to amino acid residues 557-571 of human TRPC1.Intracellular.
Cytochrome b c1 complex subunit 9 (UQCR10) Rabbit Polyclonal Antibody
TA335305

USD 375.00

5 Days

Rabbit Polyclonal Anti-UCRC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
Dopamine Transporter (SLC6A3) Goat Polyclonal Antibody
TA311170

USD 375.00

5 Days

Goat Anti-SLC6A3 / DAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QLTSSTLTNPRQSP, from the internal region (near N Terminus) of the protein sequence according to NP_001035.1.
NDUFA4L2 Rabbit Polyclonal Antibody
TA315629

USD 345.00

In Stock

Rabbit polyclonal anti-NDUFA4L2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2.