Antibodies

Jump to Filters
View as table Download
Cytochrome b c1 complex subunit 9 (UQCR10) Rabbit Polyclonal Antibody
TA335305

USD 375.00

5 Days

Rabbit Polyclonal Anti-UCRC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
NDUFA4L2 Rabbit Polyclonal Antibody
TA315629

USD 345.00

In Stock

Rabbit polyclonal anti-NDUFA4L2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2.