Antibodies

View as table Download

Rabbit Polyclonal antibody to PFK (muscle) (phosphofructokinase, muscle)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 253 of PFK (muscle) (Uniprot ID#P08237)

Rabbit Polyclonal Anti-TKTL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TKTL2 antibody: synthetic peptide directed towards the C terminal of human TKTL2. Synthetic peptide located within the following region: SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG

PFKP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PFKP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated