Angpt2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence mapping near the C-terminal (454-468) of Human Angiopoietin-2. |
Angpt2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence mapping near the C-terminal (454-468) of Human Angiopoietin-2. |
Rabbit Polyclonal Anti-ANGPT2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Angpt2 antibody is: synthetic peptide directed towards the middle region of Mouse Angpt2. Synthetic peptide located within the following region: NQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEG |