Antibodies

Jump to Filters
View as table Download
Cathepsin K (CTSK) Goat Polyclonal Antibody
TA303361

USD 375.00

5 Days

Goat Polyclonal Antibody against CTSK

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KTHRKQYNNKVDE, from the internal region (near N-terminus) of the protein sequence according to NP_000387.1.
Cathepsin K (CTSK) Rabbit Polyclonal Antibody
TA343087

USD 375.00

5 Days

Rabbit Polyclonal Anti-CTSK Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CTSK antibody: synthetic peptide directed towards the middle region of human CTSK. Synthetic peptide located within the following region: SPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMY