Cathepsin K (CTSK) Rabbit Polyclonal Antibody

CAT#: TA343087

Rabbit Polyclonal Anti-CTSK Antibody

Product Images

WB Suggested Anti-CTSK Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CTSK antibody: synthetic peptide directed towards the middle region of human CTSK. Synthetic peptide located within the following region: SPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: cathepsin K
• Database Link:
  NP_000387
  Entrez Gene 29175 RatEntrez Gene 1513 Human
  UniProt ID P43235
• Background: The protein encoded by this gene is a lysosomal cysteine proteinase involved in bone remodeling and resorption. This protein, which is a member of the peptidase C1 protein family, is predominantly expressed in osteoclasts. However, the encoded protein is also expressed in a significant fraction of human breast cancers, where it could contribute to tumor invasiveness. Mutations in this gene are the cause of pycnodysostosis, an autosomal recessive disease characterized by osteosclerosis and short stature. This gene may be subject to RNA editing.
• Synonyms: CTS02; CTSO; CTSO1; CTSO2; PKND; PYCD
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 82%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Protease
• Protein Pathways: Lysosome