CLDN15 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CLDN15 |
CLDN15 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CLDN15 |
Rabbit Polyclonal Anti-CLDN15 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLDN15 antibody: synthetic peptide directed towards the C terminal of human CLDN15. Synthetic peptide located within the following region: LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV |
Rabbit Polyclonal Anti-CLDN15 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLDN15 antibody: synthetic peptide directed towards the middle region of human CLDN15. Synthetic peptide located within the following region: LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA |
CLDN15 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CLDN15 |