Antibodies

Jump to Filters
View as table Download
CPT1B Rabbit Polyclonal Antibody
TA339410

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-CPT1B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CPT1B antibody: synthetic peptide directed towards the middle region of human CPT1B. Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
CPT1B Rabbit Polyclonal Antibody
TA313683

USD 345.00

In Stock

Rabbit polyclonal anti-CPT1B antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CPT1B.
CPT1B (C-term) Rabbit Polyclonal Antibody
AP51063PU-N

USD 450.00

2 Weeks

CPT1B (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 743-771 amino acids from the C-terminal region of Human CPT1B