Antibodies

View as table Download

Rabbit Polyclonal Anti-NOSTRIN Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NOSTRIN antibody was raised against a 17 amino acid peptide near the carboxy terminus of human NOSTRIN.

Rabbit Polyclonal Anti-ATG4A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG4A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human ATG4A.

ATG4A Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ATG4A

Goat Polyclonal Anti-FCRL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FCRL1 Antibody: Peptide with sequence C-SRLRKANITDVD, from the C Terminus of the protein sequence according to NP_443170.1; NP_001152870.1.

Rabbit Polyclonal anti-ATG4A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATG4A antibody: synthetic peptide directed towards the N terminal of human ATG4A. Synthetic peptide located within the following region: DAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDR

Rabbit Polyclonal anti-ATG4A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATG4A antibody: synthetic peptide directed towards the middle region of human ATG4A. Synthetic peptide located within the following region: PQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTF

Rabbit Polyclonal Anti-ATG4A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATG4A