Goat Anti-TMPRSS4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence DSTRCNADDAYQGE, from the internal region of the protein sequence according to NP_063947.1; NP_001077416.1. |
Goat Anti-TMPRSS4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence DSTRCNADDAYQGE, from the internal region of the protein sequence according to NP_063947.1; NP_001077416.1. |
Goat Anti-TMPRSS4 (aa245-57) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence HCFRKHTDVFNWK, from the internal region of the protein sequence according to NP_063947.1; NP_001077416.1. |
Rabbit polyclonal Anti-TMPRSS4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TMPRSS4 antibody: synthetic peptide directed towards the N terminal of human TMPRSS4. Synthetic peptide located within the following region: IPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSAT |
Rabbit polyclonal Anti-TMPRSS4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TMPRSS4 antibody: synthetic peptide directed towards the middle region of human TMPRSS4. Synthetic peptide located within the following region: LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS |
Rabbit Polyclonal Anti-TMPRSS4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TMPRSS4 |