Antibodies

Jump to Filters
View as table Download
TMPRSS4 Goat Polyclonal Antibody
TA305734

USD 375.00

In Stock

Goat Anti-TMPRSS4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence DSTRCNADDAYQGE, from the internal region of the protein sequence according to NP_063947.1; NP_001077416.1.
TMPRSS4 Goat Polyclonal Antibody
TA305735

USD 375.00

5 Days

Goat Anti-TMPRSS4 (aa245-57) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence HCFRKHTDVFNWK, from the internal region of the protein sequence according to NP_063947.1; NP_001077416.1.
TMPRSS4 Rabbit Polyclonal Antibody
TA331094

USD 375.00

5 Days

Rabbit polyclonal Anti-TMPRSS4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMPRSS4 antibody: synthetic peptide directed towards the N terminal of human TMPRSS4. Synthetic peptide located within the following region: IPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSAT
TMPRSS4 Rabbit Polyclonal Antibody
TA331095

USD 375.00

5 Days

Rabbit polyclonal Anti-TMPRSS4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMPRSS4 antibody: synthetic peptide directed towards the middle region of human TMPRSS4. Synthetic peptide located within the following region: LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS
TMPRSS4 Rabbit Polyclonal Antibody
TA350519

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-TMPRSS4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TMPRSS4