Antibodies

Jump to Filters
View as table Download
PIWIL1 Rabbit Polyclonal Antibody
TA346011

USD 475.00

5 Days

Rabbit Polyclonal Anti-PIWIL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIWIL1 antibody: synthetic peptide directed towards the N terminal of human PIWIL1. Synthetic peptide located within the following region: FQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFR
PIWIL1 Rabbit Polyclonal Antibody
TA346012

USD 475.00

5 Days

Rabbit Polyclonal Anti-PIWIL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIWIL1 antibody: synthetic peptide directed towards the middle region of human PIWIL1. Synthetic peptide located within the following region: LTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYY
PIWIL1 Rabbit Polyclonal Antibody
TA319776

USD 430.00

5 Days

Rabbit Polyclonal PIWI-L1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PIWI-L1 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human PIWI-L1.
PIWIL1 Rabbit Polyclonal Antibody
TA310121

USD 230.00

3 Weeks

Rabbit anti-PIWIL1 polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen peptide from the intermediate residues of human PIWIL1 protein.