UBE2I Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UBE2I |
UBE2I Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UBE2I |
Rabbit Polyclonal Anti-SLC38A4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLC38A4 antibody: synthetic peptide directed towards the middle region of human SLC38A4. Synthetic peptide located within the following region: LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV |
Goat Polyclonal Antibody against UBE2I
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence SGIALSRLAQERK-C, from the N Terminus of the protein sequence according to NP_003336.1; NP_919235.1; NP_919236.1; NP_919237.1. |
UBE2I Antibody - N-terminal region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human UBE2I |
Rabbit polyclonal anti-UBE2I Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UBE2I |
Rabbit polyclonal anti-UBE2I Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UBE2I |