Antibodies

Jump to Filters
View as table Download
ACADSB Rabbit Polyclonal Antibody
TA318874

USD 355.00

3 Weeks

Rabbit polyclonal anti-ACADSB antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 399 of mouse ACADSB
ACADSB Rabbit Polyclonal Antibody
TA318875

USD 355.00

3 Weeks

Rabbit polyclonal anti-ACADSB antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 399 of mouse ACADSB
ACADSB Rabbit Polyclonal Antibody
TA335016

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACADSB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACADSB antibody: synthetic peptide directed towards the middle region of human ACADSB. Synthetic peptide located within the following region: GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG