ACADSB Rabbit Polyclonal Antibody

CAT#: TA335016

Rabbit Polyclonal Anti-ACADSB Antibody

Product Images

WB Suggested Anti-ACADSB Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACADSB antibody: synthetic peptide directed towards the middle region of human ACADSB. Synthetic peptide located within the following region: GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: acyl-CoA dehydrogenase, short/branched chain
• Database Link:
  NP_001600
  Entrez Gene 36 Human
  UniProt ID P45954
• Background: Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. ACADSB has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs.Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. The ACADSB gene product has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs. The cDNA encodes for a mitochondrial precursor protein which is cleaved upon mitochondrial import and predicted to yield a mature peptide of approximately 43.7-kDa. Sequence Note: The 3' UTR extension represented by the RefSeq transcript record was derived from genomic sequence data to optimize consistency to the reference genome assembly. The extent of the UTR extension and the location of the polyA site was based on transcript alignments.
• Synonyms: 2-MEBCAD; ACAD7; SBCAD
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Yeast: 86%; Zebrafish: 79%

Reference Data

• Protein Pathways: Fatty acid metabolism, Metabolic pathways, Valine, leucine and isoleucine degradation