Rabbit polyclonal antibody to APBB3 (amyloid beta (A4) precursor protein-binding, family B, member 3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 242 and 486 of APBB3 (Uniprot ID#O95704) |
Rabbit polyclonal APBB3 Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This APBB3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-214 amino acids from the Central region of human APBB3. |
Rabbit Polyclonal Anti-APBB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APBB3 antibody: synthetic peptide directed towards the N terminal of human APBB3. Synthetic peptide located within the following region: SYIQSMEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSR |
APBB3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human APBB3 |
Germany
Japan
United Kingdom
China