APBB3 Rabbit Polyclonal Antibody

CAT#: TA340266

Rabbit Polyclonal Anti-APBB3 Antibody

Product Images

WB Suggested Anti-APBB3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-APBB3 antibody: synthetic peptide directed towards the N terminal of human APBB3. Synthetic peptide located within the following region: SYIQSMEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52
• Gene Name: amyloid beta precursor protein binding family B member 3
• Database Link:
  NP_573420
  Entrez Gene 10307 Human
  UniProt ID O95704
• Background: The protein encoded by this gene is a member of the APBB protein family. It is found in the cytoplasm and binds to the intracellular domain of the Alzheimer's disease beta-amyloid precursor protein (APP) as well as to other APP-like proteins. It is thought that the protein encoded by this gene may modulate the internalization of APP. Multiple transcript variants encoding several different isoforms have been found for this gene.
• Synonyms: FE65L2; SRA
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 86%