Rabbit polyclonal antibody to APBB3 (amyloid beta (A4) precursor protein-binding, family B, member 3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 242 and 486 of APBB3 (Uniprot ID#O95704) |
Rabbit polyclonal APBB3 Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This APBB3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-214 amino acids from the Central region of human APBB3. |
Rabbit Polyclonal Anti-APBB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APBB3 antibody: synthetic peptide directed towards the N terminal of human APBB3. Synthetic peptide located within the following region: SYIQSMEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSR |
APBB3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human APBB3 |
APBB3 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)
| Applications | FC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
APBB3 mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
