Antibodies

Jump to Filters
View as table Download
C5R1 (C5AR1) (Center) Rabbit Polyclonal Antibody
AP50640PU-N

USD 450.00

2 Weeks

C5R1 (C5AR1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human C5AR1
C5R1 (C5AR1) Rabbit Polyclonal Antibody
TA328617

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-C5a Anaphylatoxin Receptor (extracellular)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide (C)DKDTLDLNTPVDK, corresponding to amino acid residues 16-28 of human C5aR (Accession P21730 ). Extracellular, N-terminus.
C5R1 (C5AR1) Rabbit Polyclonal Antibody
TA342835

USD 375.00

5 Days

Rabbit Polyclonal Anti-C5AR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C5AR1 antibody: synthetic peptide directed towards the C terminal of human C5AR1. Synthetic peptide located within the following region: SHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKTLK
C5R1 (C5AR1) Rabbit Polyclonal Antibody
TA374159

USD 220.00

3 Weeks

C5AR1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human C5AR1 (NP_001727.1).
Modifications Unmodified