Antibodies

View as table Download

Rabbit Polyclonal Anti-CAPZB Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Capzb antibody is: synthetic peptide directed towards the C-terminal region of Rat Capzb. Synthetic peptide located within the following region: VEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEAL

Rabbit Polyclonal antibody to CAPZB (capping protein (actin filament) muscle Z-line, beta)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 256 of CAPZB

CAPZB (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human CAPZB

CAPZB (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human CAPZB

Goat Polyclonal Antibody against CAPZB

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence NDLVEALKRKQQC, from the C Terminus of the protein sequence according to NP_004921.

CAPZB Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human CAPZB

CAPZB Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-272 of human CAPZB (NP_004921.1).
Modifications Unmodified