Goat Polyclonal Antibody against CBX1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QSQKTAHETDKSE, from the internal region of the protein sequence according to NP_006798.1. |
Goat Polyclonal Antibody against CBX1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QSQKTAHETDKSE, from the internal region of the protein sequence according to NP_006798.1. |
Rabbit Polyclonal Anti-CBX1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CBX1 Antibody: synthetic peptide directed towards the N terminal of human CBX1. Synthetic peptide located within the following region: MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDN |
Rabbit Polyclonal Anti-CBX1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CBX1 Antibody: synthetic peptide directed towards the middle region of human CBX1. Synthetic peptide located within the following region: PDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKP |
CBX1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human CBX1 (NP_006798.1). |
Modifications | Unmodified |