Antibodies

Jump to Filters
View as table Download
AMCase (CHIA) (N-term) Rabbit Polyclonal Antibody
AP50895PU-N

USD 450.00

2 Weeks

AMCase (CHIA) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 20-47 amino acids from the N-terminal region of human CHIA.
AMCase (CHIA) Rabbit Polyclonal Antibody
TA329462

USD 375.00

5 Days

Rabbit Polyclonal anti-CHIA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHIA antibody: synthetic peptide directed towards the N terminal of human CHIA. Synthetic peptide located within the following region: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL
AMCase (CHIA) Rabbit Polyclonal Antibody
TA329463

USD 375.00

5 Days

Rabbit Polyclonal anti-CHIA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHIA antibody: synthetic peptide directed towards the middle region of human CHIA. Synthetic peptide located within the following region: GSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFP
AMCase (CHIA) Rabbit Polyclonal Antibody
TA374737

USD 220.00

3 Weeks

CHIA Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-368 of human CHIA (NP_001244932.1).
Modifications Unmodified
AMCase (CHIA) Rabbit Polyclonal Antibody
TA374738

USD 220.00

3 Weeks

CHIA Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-368 of human CHIA (NP_001244932.1).
Modifications Unmodified