Antibodies

Jump to Filters
View as table Download
GART Rabbit Polyclonal Antibody
TA338360

USD 375.00

5 Days

Rabbit Polyclonal Anti-GART Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GART antibody: synthetic peptide directed towards the middle region of human GART. Synthetic peptide located within the following region: VLKNGSLTNHFSFEKKKARVAVLISGTGSNLQALIDSTREPNSSAQIDIV
GART Rabbit Polyclonal Antibody
TA376484

USD 220.00

3 Weeks

GART Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-320 of human GART (NP_000810.1).
Modifications Unmodified