GART Rabbit Polyclonal Antibody

CAT#: TA338360

Rabbit Polyclonal Anti-GART Antibody

Product Images

WB Suggested Anti-GART Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: 721_B cell lysate.GART is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GART antibody: synthetic peptide directed towards the middle region of human GART. Synthetic peptide located within the following region: VLKNGSLTNHFSFEKKKARVAVLISGTGSNLQALIDSTREPNSSAQIDIV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 108 kDa
• Gene Name: phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase
• Database Link:
  NP_000810
  Entrez Gene 2618 Human
  UniProt ID P22102
• Background: The protein encoded by this gene is a trifunctional polypeptide. It has phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase activity which is required for de novo purine biosynthesis. This enzyme is highly conserved in vertebrates. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
• Synonyms: AIRS; GARS; GARTF; PAIS; PGFT; PRGS
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 83%

Reference Data

• Protein Pathways: Metabolic pathways, One carbon pool by folate, Purine metabolism