Antibodies

View as table Download

GHRHR (C-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide from Human GHRHR.
Epitope: C-Terminus.

Rabbit polyclonal anti-GHRHR antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GHRHR.

Rabbit Polyclonal Anti-GHRHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the N terminal of human GHRHR. Synthetic peptide located within the following region: VTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEE

Rabbit Polyclonal Anti-GHRHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the middle region of human GHRHR. Synthetic peptide located within the following region: PYPVACPVPLELLAEEESYFSTVKIIYTVGHSISIVALFVAITILVALRR

Rabbit Polyclonal Anti-GHRHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the C terminal of human GHRHR. Synthetic peptide located within the following region: YWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWYCVFV

GHRHR Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human GHRHR (NP_000814.2).
Modifications Unmodified