Antibodies

View as table Download

Rabbit Polyclonal Anti-mGluR7 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide TISGSKKEDTDRKC, corresponding to amino acid residues 377-390 of rat mGluR7 . Extracellular, N-terminus.

Metabotropic Glutamate Receptor 7 (GRM7) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 860-918 of Human mGluR-7.

Rabbit polyclonal anti-GRM7 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human GRM7.
Modifications Phospho-specific

Rabbit polyclonal anti-GluR7 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GluR7.
Modifications Phospho-specific

Rabbit Polyclonal Anti-mGluR7 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-mGluR7 Antibody: A synthesized peptide derived from human mGluR7

Goat Anti-GRM7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence NCKLTISGSKKEDT, from the internal region of the protein sequence according to NP_000835.1; NP_870989.1.

Rabbit Anti-Metabotropic Glutamate Receptor 7 (Ser862) Antibody (Phospho-Specific)

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser862 conjugated to KLH
Modifications Phospho-specific

Rabbit Polyclonal Anti-GRM7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRM7 antibody: synthetic peptide directed towards the C terminal of human GRM7. Synthetic peptide located within the following region: HPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNS