USD 375.00
5 Days
Rabbit Polyclonal Anti-IVNS1ABP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IVNS1ABP Antibody: synthetic peptide directed towards the N terminal of human IVNS1ABP. Synthetic peptide located within the following region: RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK |
USD 310.00
5 Days
Rabbit Polyclonal Anti-IVNS1ABP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IVNS1ABP Antibody: synthetic peptide directed towards the N terminal of human IVNS1ABP. Synthetic peptide located within the following region: MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVL |
USD 424.00
5 Days
Rabbit Polyclonal NS1-BP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Within the range of amino acids 24-84 of human Influenza A H1N1 nonstructural protein were used as the immunogen. |
USD 220.00
3 Weeks
IVNS1ABP Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human IVNS1ABP (NP_006460.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
