Antibodies

View as table Download

Rabbit Polyclonal Anti-KV1.3 (extracellular)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide KDYPASTSQDSFEA(C), corresponding to amino acid residues 263-276 of human Kv1.3.Extracellular loop between domains S1 and S2.

KCNA3 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

KCNA3 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 238-268 amino acids from the Central region of human KCNA3

Rabbit Polyclonal Anti-KV1.3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human Kv1.3. Intracellular, C-terminus.