Rabbit Polyclonal Anti-Kcnh8 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Kcnh8 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVGSSPQRTEAHEQNPADSELHHSPNLDYSPSHCQVIQEGHLQFLRCISP |
Rabbit polyclonal Anti-KV12.1 (Elk1)
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide EDKKEDRAKGRSRAG(C), corresponding to amino acid residues 143-157 of rat Kv12.1. Intracellular, N-terminal part. |
KCNH8 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human KCNH8 |
Germany
Japan
United Kingdom
China