KCNH8 Rabbit Polyclonal Antibody

CAT#: TA338733

Rabbit Polyclonal Anti-Kcnh8 Antibody

Product Images

WB Suggested Anti-Kcnh8 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Kcnh8 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVGSSPQRTEAHEQNPADSELHHSPNLDYSPSHCQVIQEGHLQFLRCISP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 123 kDa
• Gene Name: potassium voltage-gated channel subfamily H member 8
• Database Link:
  NP_653234
  Entrez Gene 211468 Mouse
  UniProt ID Q96L42
• Background: Pore-forming (alpha) subunit of voltage-gated potassium channel. Elicits a slowly activating, outward rectifying current (By similarity). Channel properties may be modulated by cAMP and subunit assembly.
• Synonyms: ELK; ELK1; elk3; Kv12.1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 92%; Guinea pig: 86%; Rat: 85%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane