Rabbit anti-MLKL Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MLKL |
Rabbit anti-MLKL Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MLKL |
Rabbit Polyclonal Anti-MLKL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MLKL antibody: synthetic peptide directed towards the N terminal of human MLKL. Synthetic peptide located within the following region: DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE |
MLKL Antibody - middle region
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse MLKL |
MLKL Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of mouse MLKL |
Modifications | Unmodified |
MLKL Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of mouse MLKL |
Modifications | Unmodified |
MLKL Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MLKL |
Modifications | Unmodified |
Phospho-MLKL-T357/S358/S360 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T357/S358/S360 of human MLKL. |
Modifications | Phospho T357/S358/S360 |
Phospho-MLKL-S358 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | A phospho synthetic peptide corresponding to residues surrounding S358 of human MLKL. |
Modifications | Phospho S358 |
Phospho-MLKL-S345 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A phospho synthetic peptide corresponding to residues surrounding S345 of Mouse MLKL. |
Modifications | Phospho S345 |