MLKL Rabbit Polyclonal Antibody

CAT#: TA338895

Rabbit Polyclonal Anti-MLKL Antibody

Product Images

WB Suggested Anti-MLKL Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human kidney (Human 293T Whole Cell)

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MLKL antibody: synthetic peptide directed towards the N terminal of human MLKL. Synthetic peptide located within the following region: DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: mixed lineage kinase domain-like
• Database Link:
  NP_689862
  Entrez Gene 197259 Human
  UniProt ID Q8NB16
• Background: The specific function of this protein remains unknown.
• Synonyms: hMLKL
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 91%; Rat: 90%; Bovine: 85%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase