Rabbit Polyclonal Anti-MSI2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSI2 antibody: synthetic peptide directed towards the N terminal of human MSI2. Synthetic peptide located within the following region: LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL |
Rabbit Polyclonal Anti-MSI2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSI2 antibody: synthetic peptide directed towards the N terminal of human MSI2. Synthetic peptide located within the following region: EANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECM |
Rabbit Polyclonal Anti-MSI2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSI2 antibody: synthetic peptide directed towards the middle region of human MSI2. Synthetic peptide located within the following region: YTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPDYLPVSQDIIFI |
Goat Anti-MSI2 (aa33-43) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SPDSLRDYFSK, from the internal region of the protein sequence according to NP_620412.1; NP_733839.1. |
Goat Anti-MSI2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence QGTSGSANDSQHD-C, from the N Terminus of the protein sequence according to NP_620412.1. |
Germany
Japan
United Kingdom
China
