Antibodies

View as table Download

Goat Polyclonal Antibody against NEDD9

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence NKPQNKCDDLDR, from the internal region of the protein sequence according to NP_006394.1; NP_892011.2.

Rabbit Polyclonal Anti-NEDD9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEDD9 antibody: synthetic peptide directed towards the middle region of human NEDD9. Synthetic peptide located within the following region: HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH

Rabbit Polyclonal Anti-NEDD9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEDD9 antibody: synthetic peptide directed towards the middle region of human NEDD9. Synthetic peptide located within the following region: DLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTA

Rabbit Polyclonal Anti-NEDD9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NEDD9

NEDD9 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human NEDD9 (NP_892011.2).
Modifications Unmodified

NEDD9 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-174 of human NEDD9 (NP_892011.2).
Modifications Unmodified