Goat Polyclonal Antibody against NEDD9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence NKPQNKCDDLDR, from the internal region of the protein sequence according to NP_006394.1; NP_892011.2. |
Goat Polyclonal Antibody against NEDD9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence NKPQNKCDDLDR, from the internal region of the protein sequence according to NP_006394.1; NP_892011.2. |
Rabbit Polyclonal Anti-NEDD9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NEDD9 antibody: synthetic peptide directed towards the middle region of human NEDD9. Synthetic peptide located within the following region: HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH |
Rabbit Polyclonal Anti-NEDD9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NEDD9 antibody: synthetic peptide directed towards the middle region of human NEDD9. Synthetic peptide located within the following region: DLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTA |
Rabbit Polyclonal Anti-NEDD9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NEDD9 |
NEDD9 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human NEDD9 (NP_892011.2). |
Modifications | Unmodified |
NEDD9 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-174 of human NEDD9 (NP_892011.2). |
Modifications | Unmodified |