Antibodies

View as table Download

Rabbit anti-OPTN Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human OPTN

Rabbit Polyclonal Anti-OPTN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OPTN antibody: synthetic peptide directed towards the N terminal of human OPTN. Synthetic peptide located within the following region: SHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTEN

Rabbit Polyclonal Anti-OPTN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OPTN antibody: synthetic peptide directed towards the N terminal of human OPTN. Synthetic peptide located within the following region: LSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERS

Rabbit Polyclonal Anti-OPTN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OPTN Antibody: synthetic peptide directed towards the C terminal of human OPTN. Synthetic peptide located within the following region: SDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII