Antibodies

Jump to Filters
View as table Download
Melanoma gp100 (PMEL) Goat Polyclonal Antibody
TA302608

USD 375.00

In Stock

Goat Polyclonal Antibody against Silver homologue / Pmel 17

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CPIGENSPLLSGQQ, from the C Terminus of the protein sequence according to NP_008859.1.
Melanoma gp100 (PMEL) Rabbit Polyclonal Antibody
TA341871

USD 310.00

5 Days

Rabbit Polyclonal Anti-SILV Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SILV antibody: synthetic peptide directed towards the N terminal of human SILV. Synthetic peptide located within the following region: HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY
Melanoma gp100 (PMEL) Rabbit Polyclonal Antibody
TA380075

USD 220.00

3 Weeks

PMEL Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-300 of human PMEL (NP_008859.1).
Modifications Unmodified