Rabbit Polyclonal PRCC Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal PRCC Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Anti-PRCC Antibody - C-terminal region
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Prcc antibody is: synthetic peptide directed towards the C-terminal region of Rat Prcc. Synthetic peptide located within the following region: KKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKYG |