Antibodies

View as table Download

Rabbit Polyclonal Anti-PRMT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRMT1 antibody: synthetic peptide directed towards the middle region of human PRMT1. Synthetic peptide located within the following region: ESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY

PRMT1 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen PRMT1 antibody was raised against kLH conjugated synthetic peptide selected from the C-terminal region of human PRMT1.

PRMT1 (C-term) rabbit polyclonal antibody, Ig Fraction

Applications IHC, WB
Reactivities Human, Mouse
Immunogen PRMT1 antibody was raised against kLH conjugated synthetic peptide selected from the C-terminal region of human PRMT1.

PRMT1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-353 of human PRMT1 (NP_938074.2).
Modifications Unmodified