PRMT1 Rabbit Polyclonal Antibody

CAT#: TA345680

Rabbit Polyclonal Anti-PRMT1 Antibody

Product Images

WB Suggested Anti-PRMT1 Antibody Titration: 5.0 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Jurkat cell lysate

• 

  Rabbit Anti-PRMT1 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRMT1 antibody: synthetic peptide directed towards the middle region of human PRMT1. Synthetic peptide located within the following region: ESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: protein arginine methyltransferase 1
• Database Link:
  NP_001527
  Entrez Gene 3276 Human
  UniProt ID Q99873
• Background: PRMT1 is a protein arginine methyltransferase that functions as a histone methyltransferase specific for H4.The HRMT1L2 gene encodes a protein arginine methyltransferase that functions as a histone methyltransferase specific for H4 (see MIM 602822). [supplied by OMIM]
• Synonyms: ANM1; HCP1; HRMT1L2; IR1B4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%