Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Anti-Rab27 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a and rab27b produced in E. coli. |
Goat Polyclonal Anti-Rab27 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a and rab27b produced in E. coli. |
Rabbit anti-RAB27A Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human RAB27A |
Rabbit polyclonal Anti-RAB27A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB27A antibody: synthetic peptide directed towards the middle region of human RAB27A. Synthetic peptide located within the following region: SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG |
Rab27a Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- RAB27A
Applications
- WB
Clonalities
- Polyclonal