RAB27A Rabbit Polyclonal Antibody
Other products for "RAB27A"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RAB27A antibody: synthetic peptide directed towards the middle region of human RAB27A. Synthetic peptide located within the following region: SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 25 kDa |
Gene Name | RAB27A, member RAS oncogene family |
Database Link | |
Background | The protein encoded byThis gene belongs toThe small GTPase superfamily, Rab family.The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations inThis gene are associated with Griscelli syndrome type 2. Alternative splicing occurs atThis locus and four transcript variants encodingThe same protein have been identified. [provided by RefSeq, Jul 2008] |
Synonyms | GS2; HsT18676; RAB27; RAM |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 86%; Goat: 79%; Horse: 79%; Sheep: 79%; Bovine: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.