RAB27A Rabbit Polyclonal Antibody

CAT#: TA342222

Rabbit polyclonal Anti-RAB27A Antibody

Product Images

WB Suggested Anti-RAB27A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAB27A antibody: synthetic peptide directed towards the middle region of human RAB27A. Synthetic peptide located within the following region: SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: RAB27A, member RAS oncogene family
• Database Link:
  NP_004571
  Entrez Gene 5873 Human
  UniProt ID P51159
• Background: The protein encoded byThis gene belongs toThe small GTPase superfamily, Rab family.The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations inThis gene are associated with Griscelli syndrome type 2. Alternative splicing occurs atThis locus and four transcript variants encodingThe same protein have been identified. [provided by RefSeq, Jul 2008]
• Synonyms: GS2; HsT18676; RAB27; RAM
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 86%; Goat: 79%; Horse: 79%; Sheep: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome