Antibodies

Jump to Filters
View as table Download
Serine racemase (SRR) Rabbit Polyclonal Antibody
TA344714

USD 475.00

5 Days

Rabbit Polyclonal Anti-SRR Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SRR antibody: synthetic peptide directed towards the middle region of human SRR. Synthetic peptide located within the following region: GVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQ
Serine racemase (SRR) Rabbit Polyclonal Antibody
TA382014

USD 220.00

3 Weeks

SRR Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-340 of human SRR (NP_068766.1).
Modifications Unmodified