Serine racemase (SRR) Rabbit Polyclonal Antibody

CAT#: TA344714

Rabbit Polyclonal Anti-SRR Antibody - middle region

Product Images

WB Suggested Anti-SRR Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: HCT15 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SRR antibody: synthetic peptide directed towards the middle region of human SRR. Synthetic peptide located within the following region: GVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: serine racemase
• Database Link:
  NP_068766
  Entrez Gene 63826 Human
  UniProt ID Q9GZT4
• Background: SRR catalyzes the synthesis of D-serine from L-serine.
• Synonyms: ILV1; ISO1
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Bovine: 79%

Reference Data

• Protein Pathways: Glycine, serine and threonine metabolism