Antibodies

View as table Download

Rabbit Polyclonal Anti-Patched Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Patched Antibody: A synthesized peptide derived from human Patched

Goat Polyclonal Antibody against PTCH

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-HPESRHHPPSNPRQQ, from the internal region of the protein sequence according to NP_000255.1.

Rabbit Polyclonal Anti-PTCH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTCH1 antibody: synthetic peptide directed towards the C terminal of human PTCH1. Synthetic peptide located within the following region: TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM

Rabbit Polyclonal Patched 1 Antibody

Applications WB
Reactivities Chicken, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to residues 269-279 of the human and mouse PTCH protein.

Carrier-free (BSA/glycerol-free) Patched1 mouse monoclonal antibody, clone OTI3c2 (formerly 3c2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) Patched1 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTCH1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTCH1 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTCH1 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTCH1 mouse monoclonal antibody, clone OTI6C10 (formerly 6C10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-Patched1 (Patched) mouse monoclonal antibody, clone OTI3c2 (formerly 3c2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-Patched1 (Patched) mouse monoclonal antibody, clone OTI3c2 (formerly 3c2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Patched1 (Patched) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Patched1 (Patched) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PTCH1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PTCH1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PTCH1 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PTCH1 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PTCH1 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PTCH1 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PTCH1 mouse monoclonal antibody, clone OTI6C10 (formerly 6C10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PTCH1 mouse monoclonal antibody, clone OTI6C10 (formerly 6C10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated