Rabbit Polyclonal Del-1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human protein (within residues 200-350). [Swiss-Prot# O43854] |
Rabbit Polyclonal Del-1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human protein (within residues 200-350). [Swiss-Prot# O43854] |
Rabbit Polyclonal Anti-EDIL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EDIL3 antibody: synthetic peptide directed towards the N terminal of human EDIL3. Synthetic peptide located within the following region: EPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNI |
Rabbit Polyclonal Anti-EDIL3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human EDIL3 |