Antibodies

Jump to Filters
View as table Download
RPS18 Rabbit Polyclonal Antibody
TA314493

USD 345.00

In Stock

Rabbit polyclonal anti-RPS18 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human RPS18.
RPS18 Rabbit Polyclonal Antibody
TA330910

USD 375.00

5 Days

Rabbit Polyclonal Anti-RPS18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS18 antibody is: synthetic peptide directed towards the C-terminal region of Human RPS18. Synthetic peptide located within the following region: NGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSK