Antibodies

View as table Download

Rabbit Polyclonal Anti-Claudin 4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 4 Antibody: A synthesized peptide derived from human Claudin 4

Rabbit polyclonal anti-Claudin 4 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Claudin 4.

Rabbit Polyclonal CLAUDIN4 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CLAUDIN4 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human CLAUDIN4.

Rabbit Polyclonal Anti-CLDN4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN4 antibody is: synthetic peptide directed towards the C-terminal region of Human CLDN4. Synthetic peptide located within the following region: KREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAAS

Anti-CLDN4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 193-209 amino acids of Human claudin 4

Anti-CLDN4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 193-209 amino acids of Human claudin 4