Antibodies

View as table Download

GAPDH mouse monoclonal antibody, clone H8, Purified

Applications ELISA, WB
Reactivities Bacteria, Human, Insect, Mouse, Rabbit, Rat, Yeast
Conjugation Unconjugated

GAPDH mouse monoclonal antibody, clone H8, Purified

Applications ELISA, WB
Reactivities Bacteria, Human, Insect, Mouse, Rabbit, Rat, Yeast
Conjugation Unconjugated

Rabbit Polyclonal Anti-GABARAP

Applications WB
Reactivities Human, Manducasexta
Conjugation Unconjugated
Immunogen The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL